PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.E04231.1.p
Common NameEUGRSUZ_E04231
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family G2-like
Protein Properties Length: 411aa    MW: 45149.8 Da    PI: 10.7712
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.E04231.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like60.33.9e-191621972055
           G2-like  20 qLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                       qLGG+ kAtPk+i+++m+vkgLtl h+kSHLQkYRl
  Eucgr.E04231.1.p 162 QLGGAGKATPKAIMRTMNVKGLTLFHLKSHLQKYRL 197
                       8**********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.63E-7162199IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.0E-16162198IPR009057Homeodomain-like
TIGRFAMsTIGR015578.8E-12162198IPR006447Myb domain, plants
PfamPF143791.5E-14238283IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 411 aa     Download sequence    Send to blast
MQYPILIDTK HVKEGELANQ KRFPVIVVSS SSSSSFSIFT LYCPHSPPPP PPPPPPLPLF  60
LLLVRRGSPA VRGASGGPVR SGPAAGGWVG LAFFRFRVDV PEADPAPRGA HRPPRRLRRR  120
RRRRRRRARA PGGPVPRADL RSQAPAPLDD RSPRALRRRR PQLGGAGKAT PKAIMRTMNV  180
KGLTLFHLKS HLQKYRLGKQ SGKEGADAPK DGSYLLENPG SGNSTPSLPS SDLNENYEVK  240
EALRAQMEMQ SKLHLQVEAE KHLQIRQEAE RRYMAMLERA CKMLADQFIT SAIIDNENQK  300
CQAYGVRMPR NPSIDPFGFY THEVAAVHGT EDDLPPSLHS QRGDCSTESC LTSHESPRIL  360
ALEESPAGGK KRPMGIDSTS APLIWSEAKL KIQDVAVPQV SPHGLTGFGM *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1114121RRLRRRRR
2115122RLRRRRRR
3118126RRRRRRRRR
4118128RRRRRRRRRAR
5119126RRRRRRRR
6120126RRRRRRR
7121128RRRRRRAR
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.E04231.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010059710.11e-174PREDICTED: uncharacterized protein LOC104447696
TrEMBLA0A059CB780.0A0A059CB78_EUCGR; Uncharacterized protein
STRINGGLYMA15G12930.11e-117(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17085911
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13640.12e-39G2-like family protein